ZFAND5 Polyclonal antibody

• 

  WB analysis using 25048-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25048-1-AP (ZFAND5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

ZFAND5 Polyclonal Antibody for WB, ELISA

Cat No. 25048-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

AN1-type zinc finger protein 5, ZFAND5A, Zinc finger A20 domain-containing protein 2, ZNF216

---

Tested Applications

• Positive WB detected in: HepG2 cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25048-1-AP targets ZFAND5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19311

  Product name: Recombinant human ZFAND5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 75-141 aa of BC027707

  Sequence: NCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEE

• Full Name: zinc finger, AN1-type domain 5
• Calculated Molecular Weight: 213 aa, 23 kDa
• Observed Molecular Weight: 23-35 kDa
• GenBank Accession Number: BC027707
• Gene Symbol: ZFAND5
• Gene ID (NCBI): 7763
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O76080
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZFAND5 is Involved in protein degradation via the ubiquitin-proteasome system and may act by anchoring ubiquitinated proteins to the proteasome. It plays a role in ubiquitin-mediated protein degradation during muscle atrophy and in the regulation of NF-kappa-B activation and apoptosis. It can inhibit NF-kappa-B activation triggered by overexpression of RIPK1 and TRAF6 but not of RELA. It also inhibits tumor necrosis factor (TNF), IL-1, and TLR4-induced NF-kappa-B activation in a dose-dependent manner.