ZFC3H1 Polyclonal antibody

• 

  WB analysis using 30834-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30834-1-AP (ZFC3H1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of DU 145 using 30834-1-AP

  IP result of anti-ZFC3H1 (IP:30834-1-AP, 4ug; Detection:30834-1-AP 1:400) with DU 145 cells lysate 1360 ug.

• 

  IF Staining of U2OS using 30834-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using ZFC3H1 antibody (30834-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

ZFC3H1 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 30834-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, ELISA

Synonyms

CCDC131, CSRC2, KIAA0546, PSRC2

---

Tested Applications

• Positive WB detected in: DU 145 cells, HEK-293T cells
• Positive IP detected in: DU 145 cells
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30834-1-AP targets ZFC3H1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34224

  Product name: Recombinant human ZFC3H1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1800-1989 aa of BC156732

  Sequence: RNKVQEFKFFTDLVNRCLVTVPARYPIPFSSADYWSNYEFHNRVIFFYLSCVPKTQHSKTLERFCSVMPANSGLALRLLQHEWEESNVQILKLQAKMFTYNIPTCLATWKIAIAAEIVLKGQREVHRLYQRALQKLPLCASLWKDQLLFEASEGGKTDNLRKLVSKCQEIGVSLNELLNLNSNKTESKNH

• Full Name: zinc finger, C3H1-type containing
• Calculated Molecular Weight: 226 kDa
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: BC156732
• Gene Symbol: ZFC3H1
• Gene ID (NCBI): 196441
• RRID: AB_3669762
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60293
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZFC3H1, also known as CCDC131 and PSRC2, is a large protein (1989 amino acids), with a C3H1- type zinc finger motif in its center, and contains five tetratricopeptide (TRP) repeats and six halftetratricopeptide (HAT) repeats at the C-terminal region. It is involved in the processing of a variety of RNAs and plays a critical role in the degradation of nuclear RNAs (PMID: 34514952).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Fabienne (Verified Customer) (09-12-2025)

Works great in immunoprecipitation (used 3µg antibody per 250µg nuclear extracts)

• Applications: Immunoprecipitation
• Cell Tissue Type: Jurkat