ZFHX3 Polyclonal antibody

• 

  IHC staining of human breast cancer using 20157-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 20157-1-AP (ZFHX3 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 20157-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 20157-1-AP (ZFHX3 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 20157-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 20157-1-AP (ZFHX3 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 20157-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 20157-1-AP (ZFHX3 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 20157-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ZFHX3 antibody (20157-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

• 

  IF Staining of MCF-7 using 20157-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using ZFHX3 antibody (20157-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

ZFHX3 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 20157-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, ELISA

Synonyms

C16orf47, ATBT, AT-binding transcription factor 1, ATBF1, AT motif-binding factor 1

---

Tested Applications

• Positive IHC detected in: human breast cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, MCF-7 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:150-1:600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20157-1-AP targets ZFHX3 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14080

  Product name: Recombinant human ZFHX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 921-1270 aa of BC029653

  Sequence: QLVSEELMNLGESFIQTNDPSLKLFQCAVCNKFTTDNLDMLGLHMNVERSLSEDEWKAVMGDSYQCKLCRYNTQLKANFQLHCKTDKHVQKYQLVAHIKEGGKANEWRLKCVAIGNPVHLKCNACDYYTNSLEKLRLHTVNSRHEASLKLYKHLQQHESGVEGESCYYHCVLCNYSTKAKLNLIQHVRSMKHQRSESLRKLQRLQKGLPEEDEDLGQIFTIRRCPSTDPEEAIEDVEGPSETAADPEELAKDQEGGASSSQAEKELTDSPATSKRISFPGSSESPLSSKRPKTAEEIKPEQMYQCPYCKYSNADVNRLRVHAMTQHSVQPMLRCPLCQDMLNNKIHLQLH

• Full Name: zinc finger homeobox 3
• Calculated Molecular Weight: 3703 aa, 404 kDa
• GenBank Accession Number: BC029653
• Gene Symbol: ZFHX3
• Gene ID (NCBI): 463
• RRID: AB_3669324
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15911
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Zinc finger homeobox protein 3 (ZFHX3) encodes a transcription factor which contains four homeodomains and seventeen zinc fingers. The ZFHX3 transcription factor appears to regulate myogenic and neuronal differentiation. Although the function of ZFHX3 in cardiac tissue is unknown, it is expressed in mouse hearts. (PMID: 26267381)