ZFHX4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZFHX4 Polyclonal antibody (31404-1-AP)

• 

  WB analysis using 31404-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31404-1-AP (ZFHX4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

ZFHX4 Polyclonal Antibody for WB, ELISA

Cat No. 31404-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ZFH 4, ZFH4, ZFH-4, ZHF4

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31404-1-AP targets ZFHX4 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35027

  Product name: Recombinant human ZFHX4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 400-600 aa of NM_024721

  Sequence: QMPKAEVNLGGLSSLVVNTPITSVSLSHSSSESSKMSESKDQENNCERPKESNVLHPNGECPVKSEPTEPGDEDEEDAYSNELDDEEVLGELTDSIGNKDFPLLNQSISPLSSSVLKFIEKGTSSSSATVSDDTEKKKQTAAVRASGSVASNYGISGKDFADASASKDSATAAHPSEIARGDEDSSATPHQHGFTPSTPGT

• Full Name: zinc finger homeobox 4
• Calculated Molecular Weight: 394 kDa
• Observed Molecular Weight: 420 kDa
• GenBank Accession Number: NM_024721
• Gene Symbol: ZFHX4
• Gene ID (NCBI): 79776
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86UP3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The ZFHX4 protein (Zinc Finger Homeobox Protein 4) belongs to the zinc finger transcription factor family. Its structure contains multiple zinc finger motifs and a homeobox domain. It mainly regulates the expression of specific genes by binding to DNA. This protein plays a crucial role in the development and differentiation of the nervous system, participating in the precise regulation of neuronal gene expression. In the adult stage, it is also related to muscle regeneration and the regulation of tumor occurrence (such as glioblastoma and melanoma), and may act as a transcriptional repressor to influence the balance of cell proliferation and differentiation.