ZFP2 Polyclonal antibody

• 

  WB analysis of HepG2 using 24720-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 24720-1-AP (ZFP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Neuro-2a using 24720-1-AP

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 24720-1-AP (ZFP2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

ZFP2 Polyclonal Antibody for WB, ELISA

Cat No. 24720-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Zfp 2, ZFP2, Zinc finger protein 2 homolog, ZNF751

---

Tested Applications

• Positive WB detected in: HepG2 cells, Neuro-2a cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24720-1-AP targets ZFP2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20087

  Product name: Recombinant human ZFP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-120 aa of BC142989

  Sequence: MEREGIWHSTLGETWEPNNWLEGQQDSHLSQVGVTHKETFTEMRVCGGNEFERCSSQDSILDTQQSIPMVKRPHNCNSHGEDATQNSELIKTQRMFVGKKIYECNQCSKTFSQSSSLLKH

• Full Name: zinc finger protein 2 homolog (mouse)
• Calculated Molecular Weight: 461 aa, 53 kDa
• Observed Molecular Weight: 53-55 kDa
• GenBank Accession Number: BC142989
• Gene Symbol: ZFP2
• Gene ID (NCBI): 80108
• RRID: AB_2879687
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZN57
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.