• Featured Product
  • KD/KO Validated

ZFP36L1/2 Polyclonal antibody

ZFP36L1/2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 12306-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

ZFP36L1, EGF-response factor 1, ERF-1, mRNA decay activator protein ZFP36L1, TPA-induced sequence 11b

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU-937 cells, 3T3-L1 cells, RAW 264.7 cells, HeLa cells
Positive IHC detected inrat ovary tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12306-1-AP targets ZFP36L1/2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2952

Product name: Recombinant human ZFP36L1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-338 aa of BC018340

Sequence: MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD

Predict reactive species
Full Name zinc finger protein 36, C3H type-like 1
Calculated Molecular Weight 338 aa, 36 kDa
Observed Molecular Weight 45-50 kDa
GenBank Accession NumberBC018340
Gene Symbol ZFP36L1
Gene ID (NCBI) 677
RRIDAB_2737443
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ07352
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZFP36L1, also named as Butyrate response factor 1 or TPA-induced sequence 11b, is a 338 amino acid protein, which is phosphorylated by RPS6KA1 at Ser-334 upon phorbol 12-myristate 13-acetate (PMA) treatment. ZFP36 encodes tristetraprolin (TTP) the prototype of a small family of RBPs, called the ZFP36 family, that are characterised by highly conserved tandem CCCH zinc-finger RNA-binding domains [PMID: 10751406]. ZFP36 is a RBP that promotes RNA decay and negatively regulates the expression of the myogenic regulatory factor MyoD by binding to the 3'UTR of MyoD mRNA [PMID: 25815583]. Mouse satellite cells from Zfp36-deficient mice express increased amounts of MyoD and display impaired satellite activation, demonstrating a role for ZFP36 in the maintenance of quiescence [PMID: 25815583]. The functions of the ZFP36L1 and ZFP36L2 family members have not been evaluated in skeletal muscle stem cell fate, but have been shown to act redundantly to promote quiescence during lymphocyte development. ZFP36L1 has been implicated in the persistence of the marginal zone B lymphocyte population. ZFP36L1 exists three isoform through blasting on NCBI database and can be phosphorylated, so the range of the molecular weight of ZFP36L1 is about 40-50 kDa. (PMID: 26180518, PMID: 17030620). This antibody recognizes both ZFP36L1 and ZFP36L2.

Protocols

Product Specific Protocols
WB protocol for ZFP36L1/2 antibody 12306-1-APDownload protocol
IHC protocol for ZFP36L1/2 antibody 12306-1-APDownload protocol
IF protocol for ZFP36L1/2 antibody 12306-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cell

A Membraneless Organelle Associated with the Endoplasmic Reticulum Enables 3'UTR-Mediated Protein-Protein Interactions.

Authors - Weirui Ma
humanIF

Mol Ther Nucleic Acids

The miR-93-3p/ZFP36L1/ZFX axis regulates keratinocyte proliferation and migration during skin wound healing.

Authors - Xiao Feng
  • KD Validated
mouseWB,IHC,IF

Cell Death Dis

ZFP36L2 regulates myocardial ischemia/reperfusion injury and attenuates mitochondrial fusion and fission by LncRNA PVT1.

Authors - Fang Wu
humanWB

J Clin Invest

EMT-activated secretory and endocytic vesicular trafficking programs underlie a vulnerability to PI4K2A antagonism in lung cancer

Authors - Xiaochao Tan
  • KD Validated
humanWB

Elife

HUWE1 controls tristetraprolin proteasomal degradation by regulating its phosphorylation

Authors - Sara Scinicariello
humanWB,IHC,IF

Heliyon

BRF1 promotes the odontogenic differentiation of dental pulp stem cells in pulpitis by inducing autophagy

Authors - Caixia Zhou
Loading...
||
New chat Able
正在加载,请稍候...