ZFP36L1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68038-1-Ig (same clone as 68038-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68038-1-Ig (ZFP36L1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 68038-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 68038-1-Ig (same clone as 68038-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 68038-1-Ig (ZFP36L1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68038-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-12 using 68038-1-Ig (same clone as 68038-1-PBS)

  PC-12 cells were subjected to SDS PAGE followed by western blot with 68038-1-Ig (ZFP36L1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68038-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 68038-1-Ig (same clone as 68038-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using ZFP36L1 antibody (68038-1-Ig, Clone: 1H6G6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68038-1-PBS in a different storage buffer formulation.

ZFP36L1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68038-1-PBS

Clone No.1H6G6

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Berg36, BRF1, Butyrate response factor 1, cMG1, EGF response factor 1, ERF 1, ERF1, Protein TIS11B, RNF162B, TIS11B, ZFP36L1

---

Product Information

68038-1-PBS targets ZFP36L1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, Rat samples.

• Tested Reactivity: Human, Rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30469

  Product name: Recombinant human ZFP36L1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-338 aa of BC018340

  Sequence: MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD

• Full Name: zinc finger protein 36, C3H type-like 1
• Calculated Molecular Weight: 338 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC018340
• Gene Symbol: ZFP36L1
• Gene ID (NCBI): 677
• RRID: AB_2918780
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q07352
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

As a member of the Tristetraprolin (TTP) RNA binding protein family, ZFP36L1 regulate gene expression post-transcriptionally by promoting mRNA decay. In mammals, ZFP36L1 and its family members have been shown to regulate development, cell diferentiation, cell cycle, apoptosis and anti-cancer capability by targeting an extensive overlapping repertoire of mRNAs.