ZFP42 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZFP42 Polyclonal antibody (31790-1-AP)

• 

  WB analysis using 31790-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31790-1-AP (ZFP42 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

ZFP42 Polyclonal Antibody for WB, ELISA

Cat No. 31790-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

hREX-1, Reduced expression protein 1, REX1, REX-1, Zfp-42

---

Tested Applications

• Positive WB detected in: HL-60 cells, LNCaP cells, PC-3 cells, Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31790-1-AP targets ZFP42 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36112

  Product name: Recombinant human ZFP42 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of BC160056

  Sequence: MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALCDGYVCYEPGPQALGGDDFSDCYIECVIRGEFSQPILEEDSLFESLEYLKKGSEQQLSQKVFEASSLECSLEYMKKGVKKELPQKIVGENSLE

• Full Name: zinc finger protein 42 homolog (mouse)
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC160056
• Gene Symbol: ZFP42
• Gene ID (NCBI): 132625
• RRID: AB_3742477
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96MM3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The ZFP42, also known as REX1, is a transcriptional regulator and a member of the zinc finger protein family. It is specifically highly expressed in pluripotent stem cells, such as embryonic stem cells, and is one of the key molecules for maintaining cell pluripotency and self-renewal capacity. Its expression level rapidly declines with cell differentiation, making it widely used as a reliable marker for the pluripotent state. Studies have shown that ZFP42 is involved in inhibiting differentiation programs and maintaining stemness by regulating the transcription of downstream target genes. Additionally, its abnormal expression in various tumors suggests that it may be involved in tumorigenesis and development, making it an important subject in the research of regenerative medicine, developmental biology, and oncology.