ZFPL1 Polyclonal antibody

• 

  WB analysis of HepG2 using 27157-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 27157-1-AP (ZFPL1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 27157-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using ZFPL1 antibody (27157-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

ZFPL1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 27157-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

D11S750, MCG4, ZFPL1, zinc finger protein like 1, Zinc finger protein MCG4

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27157-1-AP targets ZFPL1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24097

  Product name: Recombinant human ZFPL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-264 aa of BC012814

  Sequence: MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNIPLASRETTRLVCYDLFHWACLNERAAQLPRNTAPAGYQCPSCNGPIFPPTNLAGPVASALREKLATVNWARAGLGLPLIDEVVSPEPEPLNTSDFSDWSSFNASSTPGPEEVDSASAAPAFYSQAPRPPASPGRPEQHTVIHMGNPEPLTHAPRKVYDTRDDDRTPGLHGDCDDDKYRRRPALGWLARLLRSRAGSRKRPLTLLQR

• Full Name: zinc finger protein-like 1
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC012814
• Gene Symbol: ZFPL1
• Gene ID (NCBI): 7542
• RRID: AB_2880781
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95159
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Boyan (Verified Customer) (04-03-2024)

very good for IF; clear Golgi staining

• Applications: Immunofluorescence