ZFPL1 Polyclonal antibody

• 

  WB analysis of HepG2 using 27157-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 27157-1-AP (ZFPL1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 27157-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using ZFPL1 antibody (27157-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

ZFPL1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 27157-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

zinc finger protein like 1, Zinc finger protein MCG4, Zinc finger protein-like 1

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27157-1-AP targets ZFPL1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24097

  Product name: Recombinant human ZFPL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-264 aa of BC012814

  Sequence: MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNIPLASRETTRLVCYDLFHWACLNERAAQLPRNTAPAGYQCPSCNGPIFPPTNLAGPVASALREKLATVNWARAGLGLPLIDEVVSPEPEPLNTSDFSDWSSFNASSTPGPEEVDSASAAPAFYSQAPRPPASPGRPEQHTVIHMGNPEPLTHAPRKVYDTRDDDRTPGLHGDCDDDKYRRRPALGWLARLLRSRAGSRKRPLTLLQR

• Full Name: zinc finger protein-like 1
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC012814
• Gene Symbol: ZFPL1
• Gene ID (NCBI): 7542
• RRID: AB_2880781
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95159
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The ZFPL1 protein is a zinc finger protein localized to the Golgi apparatus, and its function is closely associated with maintaining Golgi structural integrity. Research indicates that ZFPL1 interacts with the Golgi matrix protein GM130 through its N-terminal domain, and this interaction is crucial for the proper anchoring of GM130 to the Golgi. When ZFPL1 expression is suppressed, GM130 dissociates from the membrane, leading to the fragmentation of the Golgi ribbon structure and significantly impairing protein secretion and transport processes. Therefore, ZFPL1 is considered a key scaffolding protein essential for maintaining the normal structure and function of the Golgi apparatus. Currently, its specific role in highly polarized cells with active secretory functions, such as neurons, is a major focus in the field.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Boyan (Verified Customer) (04-03-2024)

very good for IF; clear Golgi staining

• Applications: Immunofluorescence