ZG16 Monoclonal antibody, PBS Only

ZG16 Monoclonal Antibody for WB, IHC, IF-P, IF-Fro, Indirect ELISA
Cat No. 67389-1-PBS
Clone No.1A7B9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, IF-Fro, Indirect ELISA

1A7B9, FLJ43571, FLJ92276, hZG16, JCLN

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67389-1-PBS targets ZG16 in WB, IHC, IF-P, IF-Fro, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11332

Product name: Recombinant human ZG16 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-167 aa of BC029149

Sequence: MLTVALLALLCASASGNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRC

Predict reactive species
Full Name zymogen granule protein 16 homolog (rat)
Calculated Molecular Weight 167 aa, 18 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC029149
Gene Symbol ZG16
Gene ID (NCBI) 653808
RRIDAB_2882633
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO60844
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Zymogen granule protein 16 (ZG16) has a Jacalin-like lectin domain, which is mainly expressed by mucus-secreting cells, including goblet cells in the intestine. It's reported that ZG16 expression was significantly decreased in colorectal cancer compared to normal tissue. ZG16 gene expression and copy number variations (CNV) were associated with multiple molecular and clinicopathological features of CRC including MSI, MLH1 silencing and so on. It's found that ZG16 is negatively correlated with lymphatic invasive and distant metastasis. Besides, overexpression of ZG16 blocks PD-L1 expression in colorectal cancer, and promotes NK cells survival and proliferation. Very importantly, ZG16 suppresses colorectal tumor growth via the immune system. (PMID: 33360840, 21893569)

Loading...
||
New chat Able
正在加载,请稍候...