ZHX1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZHX1 Polyclonal antibody (13903-1-AP)

• Featured Product
• KD/KO Validated

ZHX1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 13903-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

zinc fingers and homeoboxes 1

• 

  WB analysis using 13903-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13903-1-AP (ZHX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 13903-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13903-1-AP (ZHX1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 13903-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 13903-1-AP (ZHX1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 13903-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13903-1-AP (ZHX1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 13903-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13903-1-AP (ZHX1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 13903-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13903-1-AP (ZHX1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 13903-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13903-1-AP (ZHX1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 13903-1-AP

  IP result of anti-ZHX1 (IP:13903-1-AP, 4ug; Detection:13903-1-AP 1:500) with HEK-293 cells lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ZHX1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, mouse heart tissue, mouse kidney tissue, Jurkat cells
• Positive IP detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13903-1-AP targets ZHX1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4874

  Product name: Recombinant human ZHX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 524-873 aa of BC040481

  Sequence: SNQCLHLNNDSSTTIIIDSSDETTESPTVGTAQPKQSWNPFPDFTPQKFKEKTAEQLRVLQASFLNSSVLTDEELNRLRAQTKLTRREIDAWFTEKKKSKALKEEKMEIDESNAGSSKEEAGETSPADESGAPKSGSTGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAKESGLARTDIVSWFGDTRYAWKNGNLKWYYYYQSANSSSMNGLSSLRKRGRGRPKGRGRGRPRGRPRGSKRINNWDRGPSLIKFKTGTAILKDYYLKRKFLNEQDLDELVNKSHMGYEQVREWFAERQRRSELGIELFEENEEEDEVIDDQEEDEEETDDSDTWEPPRHVKRKLSKSDD

• Full Name: zinc fingers and homeoboxes 1
• Calculated Molecular Weight: 873 aa, 98 kDa
• Observed Molecular Weight: 100-120 kDa
• GenBank Accession Number: BC040481
• Gene Symbol: ZHX1
• Gene ID (NCBI): 11244
• RRID: AB_2219214
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKY1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Binding of the nuclear factor-Y complex (NF-Y) to the inverted CCAAT-box interferes with transcription activation through nucleosome reorganization. The three homologous proteins forming the zinc-fingers and homeoboxes (ZHX) family interact with the activation domain of NF-Ya to repress transcription [PMID:19348505,20509910]. Human zinc-fingers and homeoboxes 1 (ZHX1) was cloned as a protein that interacts with the activation domain (AD) of the A subunit of nuclear factor-Y (NF-YA) [PMID:12237128].

Publications

What published studies show

The ZHX1 Polyclonal antibody (Cat# 13903-1-AP) has 4 total citations. These appear in Molecular Therapy Nucleic Acids, FASEB Journal, Tumour Biology, and PLoS ONE. The associated research fields include glioblastoma proliferation and progression, vascular remodeling and smooth muscle cell proliferation, and cholangiocarcinoma cell migration and invasion.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Ther Nucleic Acids; Blocking lncRNA MALAT1/miR-199a/ZHX1 Axis Inhibits Glioblastoma Proliferation and Progression.; Authors - Keman Liao
		FASEB J; ZHX2 Alleviates Vascular Remodeling and Smooth Muscle Cell Proliferation by Transcriptional Regulation of GADD45G.; Authors - Siyuan Fan
human	WB,IHC	Tumour Biol; Roles of zinc-fingers and homeoboxes 1 during the proliferation, migration, and invasion of glioblastoma cells.; Authors - Ryuk-Jun Kwon ; KD Validated
human	WB,IHC	PLoS One; ZHX1 Promotes the Proliferation, Migration and Invasion of Cholangiocarcinoma Cells.; Authors - Ryuk-Jun Kwon ; KD Validated