• Featured Product
  • KD/KO Validated

ZHX2 Polyclonal antibody

ZHX2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 20136-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

Regulator of AFP, RAF, KIAA0854, Alpha-fetoprotein regulator 1, AFR1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, mouse brain tissue, mouse skeletal muscle tissue, mouse ovary tissue, mouse lung tissue, rat brain tissue, Jurkat cells
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20136-1-AP targets ZHX2 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14088

Product name: Recombinant human ZHX2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 488-837 aa of BC042145

Sequence: SDHRYRCQRGIVHITSESLAKDQLAIAASRHGRTYHAYPDFAPQKFKEKTQGQVKILEDSFLKSSFPTQAELDRLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKKGQDVGAPNGALSRLDQLSGAQLTSSLPSPSPAIAKSQEQVHLLRSTFARTQWPTPQEYDQLAAKTGLVRTEIVRWFKENRCLLKTGTVKWMEQYQHQPMADDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCLPAKPSEATSDRSEGSSRDGQGSDENEESSVVDYVEVTVGEEDAISDRSDSWSQAAAEGVSELAESDSDCVPAEAGQA

Predict reactive species
Full Name zinc fingers and homeoboxes 2
Calculated Molecular Weight 837 aa, 92 kDa
Observed Molecular Weight 92-100 kDa
GenBank Accession NumberBC042145
Gene Symbol ZHX2
Gene ID (NCBI) 22882
RRIDAB_10666438
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y6X8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Zinc fingers and homeoboxes protein 2 is a protein that in humans is encoded by the ZHX2 gene. ZHX2 Act as a transcriptional repressor, represses the promoter activity of the CDC25C gene stimulated by NFYA (PMID:12741956). In addition to forming homodimers, this protein heterodimerizes with member 1 of the zinc fingers and homeoboxes family.

Protocols

Product Specific Protocols
IF protocol for ZHX2 antibody 20136-1-APDownload protocol
IHC protocol for ZHX2 antibody 20136-1-APDownload protocol
IP protocol for ZHX2 antibody 20136-1-APDownload protocol
WB protocol for ZHX2 antibody 20136-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Int J Cancer

HBV suppresses ZHX2 expression to promote proliferation of HCC through miR-155 activation.

Authors - Xiaojia Song
humanWB

J Pathol

ZHX2 inhibits SREBP1c-mediated de novo lipogenesis in hepatocellular carcinoma via miR-24-3p.

Authors - Xiangguo Yu
mouseWB

J Immunol

Zhx2 Accelerates Sepsis by Promoting Macrophage Glycolysis via Pfkfb3.

Authors - Zehua Wang
  • KO Validated
humanWB,IHC

Cancer Cell Int

ZHX2 inhibits thyroid cancer metastasis through transcriptional inhibition of S100A14.

Authors - Yankun Zhang
  • KD Validated
humanWB

Biochem Biophys Res Commun

Proliferation and osteo/odontogenic differentiation of stem cells from apical papilla regulated by Zinc fingers and homeoboxes 2: An in vitro study.

Authors - Fang Wan
  • KD Validated
humanWB,IHC

FEBS Open Bio

Upregulation of ZHX2 predicts poor prognosis and is correlated with immune infiltration in gastric cancer.

Authors - Anqi Cheng
Loading...
||
New chat Able
正在加载,请稍候...