ZHX2 Polyclonal antibody

• 

  WB analysis using 20136-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20136-1-AP (ZHX2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 20136-1-AP

  WB result of ZHX2 antibody (20136-1-AP; 1:24000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ZHX2 transfected HEK-293 cells.

• 

  WB analysis using 20136-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20136-1-AP (ZHX2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 20136-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 20136-1-AP (ZHX2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 20136-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 20136-1-AP (ZHX2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse ovary using 20136-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 20136-1-AP (ZHX2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 20136-1-AP

  IP result of anti-ZHX2 (IP:20136-1-AP, 4ug; Detection:20136-1-AP 1:800) with mouse brain tissue lysate 2800ug.

• 

  IHC staining of human colon cancer using 20136-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 20136-1-AP (ZHX2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 20136-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 20136-1-AP (ZHX2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 20136-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using ZHX2 antibody (20136-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

ZHX2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 20136-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

Synonyms

Regulator of AFP, RAF, KIAA0854, Alpha-fetoprotein regulator 1, AFR1

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, mouse brain tissue, mouse skeletal muscle tissue, mouse ovary tissue, mouse lung tissue, rat brain tissue, Jurkat cells
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 10 publications below
• IHC: See 4 publications below
• IF: See 2 publications below
• ChIP: See 1 publications below

Product Information

20136-1-AP targets ZHX2 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14088

  Product name: Recombinant human ZHX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 488-837 aa of BC042145

  Sequence: SDHRYRCQRGIVHITSESLAKDQLAIAASRHGRTYHAYPDFAPQKFKEKTQGQVKILEDSFLKSSFPTQAELDRLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKKGQDVGAPNGALSRLDQLSGAQLTSSLPSPSPAIAKSQEQVHLLRSTFARTQWPTPQEYDQLAAKTGLVRTEIVRWFKENRCLLKTGTVKWMEQYQHQPMADDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCLPAKPSEATSDRSEGSSRDGQGSDENEESSVVDYVEVTVGEEDAISDRSDSWSQAAAEGVSELAESDSDCVPAEAGQA

• Full Name: zinc fingers and homeoboxes 2
• Calculated Molecular Weight: 837 aa, 92 kDa
• Observed Molecular Weight: 92-100 kDa
• GenBank Accession Number: BC042145
• Gene Symbol: ZHX2
• Gene ID (NCBI): 22882
• RRID: AB_10666438
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6X8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Zinc fingers and homeoboxes protein 2 is a protein that in humans is encoded by the ZHX2 gene. ZHX2 Act as a transcriptional repressor, represses the promoter activity of the CDC25C gene stimulated by NFYA (PMID:12741956). In addition to forming homodimers, this protein heterodimerizes with member 1 of the zinc fingers and homeoboxes family.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int J Cancer; HBV suppresses ZHX2 expression to promote proliferation of HCC through miR-155 activation.; Authors - Xiaojia Song
human	WB	J Pathol; ZHX2 inhibits SREBP1c-mediated de novo lipogenesis in hepatocellular carcinoma via miR-24-3p.; Authors - Xiangguo Yu
mouse	WB	J Immunol; Zhx2 Accelerates Sepsis by Promoting Macrophage Glycolysis via Pfkfb3.; Authors - Zehua Wang ; KO Validated
human	WB,IHC	Cancer Cell Int; ZHX2 inhibits thyroid cancer metastasis through transcriptional inhibition of S100A14.; Authors - Yankun Zhang ; KD Validated
human	WB	Biochem Biophys Res Commun; Proliferation and osteo/odontogenic differentiation of stem cells from apical papilla regulated by Zinc fingers and homeoboxes 2: An in vitro study.; Authors - Fang Wan ; KD Validated
human	WB,IHC	FEBS Open Bio; Upregulation of ZHX2 predicts poor prognosis and is correlated with immune infiltration in gastric cancer.; Authors - Anqi Cheng