ZHX2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68268-1-Ig (same clone as 68268-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68268-1-Ig (ZHX2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68268-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 68268-1-Ig (same clone as 68268-1-PBS)

  WB result of ZHX2 antibody (68268-1-Ig; 1:24000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ZHX2 transfected HEK-293 cells. This data was developed using the same antibody clone with 68268-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68268-1-Ig (same clone as 68268-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68268-1-Ig (ZHX2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68268-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68268-1-Ig (same clone as 68268-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68268-1-Ig (ZHX2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68268-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 68268-1-Ig (same clone as 68268-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using ZHX2 antibody (68268-1-Ig, Clone: 4E12F2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68268-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ZHX2 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 68268-1-PBS

Clone No.4E12F2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

RAF, KIAA0854, Alpha-fetoprotein regulator 1, AFR1, AFP regulator 1

---

Product Information

68268-1-PBS targets ZHX2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14420

  Product name: Recombinant human ZHX2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 488-837 aa of BC042145

  Sequence: SDHRYRCQRGIVHITSESLAKDQLAIAASRHGRTYHAYPDFAPQKFKEKTQGQVKILEDSFLKSSFPTQAELDRLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKKGQDVGAPNGALSRLDQLSGAQLTSSLPSPSPAIAKSQEQVHLLRSTFARTQWPTPQEYDQLAAKTGLVRTEIVRWFKENRCLLKTGTVKWMEQYQHQPMADDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCLPAKPSEATSDRSEGSSRDGQGSDENEESSVVDYVEVTVGEEDAISDRSDSWSQAAAEGVSELAESDSDCVPAEAGQA

• Full Name: zinc fingers and homeoboxes 2
• Calculated Molecular Weight: 837 aa, 92 kDa
• Observed Molecular Weight: 92-100 kDa
• GenBank Accession Number: BC042145
• Gene Symbol: ZHX2
• Gene ID (NCBI): 22882
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y6X8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Zinc fingers and homeoboxes protein 2 is a protein that in humans is encoded by the ZHX2 gene. ZHX2 Act as a transcriptional repressor, represses the promoter activity of the CDC25C gene stimulated by NFYA (PMID:12741956). In addition to forming homodimers, this protein heterodimerizes with member 1 of the zinc fingers and homeoboxes family.