ZHX2 Monoclonal antibody, PBS Only (Capture)

Name: ZHX2 Monoclonal antibody, PBS Only (Capture), 100ug
Brand: Proteintech
SKU: 68268-1-PBS-100UG

ZHX2 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 68268-1-PBS

Clone No.4E12F2

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

4E12F2, AFP regulator 1, AFR1, Alpha-fetoprotein regulator 1, KIAA0854

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICCCytometric bead array sample testCytometric bead array

WB analysis using 68268-1-Ig (same clone as 68268-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 68268-1-Ig (ZHX2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68268-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
Various lysates were subjected to SDS PAGE followed by western blot with 68268-1-Ig (ZHX2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68268-1-PBS in a different storage buffer formulation.
WB analysis of HEK-293 using 68268-1-Ig (same clone as 68268-1-PBS)
WB result of ZHX2 antibody (68268-1-Ig; 1:24000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ZHX2 transfected HEK-293 cells. This data was developed using the same antibody clone with 68268-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 68268-1-Ig (same clone as 68268-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68268-1-Ig (ZHX2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68268-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 68268-1-Ig (same clone as 68268-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68268-1-Ig (ZHX2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68268-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of A431 using 68268-1-Ig (same clone as 68268-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed A431 cells using ZHX2 antibody (68268-1-Ig, Clone: 4E12F2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68268-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array sample test of MP51830-1
Cytometric bead array sample test of MP51830-1, ZHX2 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68268-1-PBS. Detection antibody: 68268-2-PBS.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array standard curve of MP51830-1
Cytometric bead array standard curve of MP51830-1, ZHX2 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68268-1-PBS. Detection antibody: 68268-2-PBS. Standard:Ag14420. Range: 0.781-100 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

68268-1-PBS targets ZHX2 as part of a matched antibody pair:

MP51830-1: 68268-1-PBS capture and 68268-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse, rat, pig, rabbit
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag14420 Product name: Recombinant human ZHX2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 488-837 aa of BC042145 Sequence: SDHRYRCQRGIVHITSESLAKDQLAIAASRHGRTYHAYPDFAPQKFKEKTQGQVKILEDSFLKSSFPTQAELDRLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKKGQDVGAPNGALSRLDQLSGAQLTSSLPSPSPAIAKSQEQVHLLRSTFARTQWPTPQEYDQLAAKTGLVRTEIVRWFKENRCLLKTGTVKWMEQYQHQPMADDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCLPAKPSEATSDRSEGSSRDGQGSDENEESSVVDYVEVTVGEEDAISDRSDSWSQAAAEGVSELAESDSDCVPAEAGQA Predict reactive species
Full Name	zinc fingers and homeoboxes 2
Calculated Molecular Weight	837 aa, 92 kDa
Observed Molecular Weight	92-100 kDa
GenBank Accession Number	BC042145
Gene Symbol	ZHX2
Gene ID (NCBI)	22882
RRID	AB_2935352
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	Q9Y6X8
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Zinc fingers and homeoboxes protein 2 is a protein that in humans is encoded by the ZHX2 gene. ZHX2 Act as a transcriptional repressor, represses the promoter activity of the CDC25C gene stimulated by NFYA (PMID:12741956). In addition to forming homodimers, this protein heterodimerizes with member 1 of the zinc fingers and homeoboxes family.