ZIC5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZIC5 Polyclonal antibody (34277-1-AP)

• 

  WB analysis using 34277-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34277-1-AP (ZIC5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

ZIC5 Polyclonal Antibody for WB, ELISA

Cat No. 34277-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Zic Family Member 5, Zic Family Zinc Finger 5, Zinc finger protein of the cerebellum 5, Zinc finger protein ZIC 5

---

Tested Applications

• Positive WB detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34277-1-AP targets ZIC5 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag41531

  Product name: Recombinant huma ZIC5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 550-639 aa of NM_033132

  Sequence: IHCKSPPPSPGPLGYSSVGTPVGAPLSPVLDPARSHSSTLSPQVTNLNEWYVCQASGAPSHLHTPSSNGTTSETEDEEIYGNPEVVRTIH

• Full Name: Zic family member 5 (odd-paired homolog, Drosophila)
• Calculated Molecular Weight: 639aa, 66 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: NM_033132
• Gene Symbol: ZIC5
• Gene ID (NCBI): 85416
• RRID: AB_3743183
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96T25
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZIC5 (Zinc Finger of the Cerebellum 5) is a C2H2-type zinc finger protein belonging to the ZIC family. This protein plays an important role in neural development, participating in neural crest cell differentiation, neural tube formation, and the establishment of the left-right axis. Recent studies have found that ZIC5 is significantly overexpressed in various malignant tumors, including colon cancer, prostate cancer, cervical cancer, lung cancer, hepatocellular carcinoma, and melanoma. It promotes tumor cell proliferation, invasion, migration, and epithelial-mesenchymal transition (EMT) by activating the Wnt/β-catenin signaling pathway. ZIC5 enhances cancer stem cell properties and is positively correlated with the expression of stemness markers. It serves as an independent prognostic marker for colon cancer, and its high expression is closely associated with poor patient survival.