ZMYM3 Polyclonal antibody

• 

  WB analysis of mouse brain using 25742-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25742-1-AP (ZMYM3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 25742-1-AP

  IP result of anti-ZMYM3 (IP:25742-1-AP, 4ug; Detection:25742-1-AP 1:300) with K-562 cells lysate 3600ug.

• 

  IHC staining of human ovary tumor using 25742-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 25742-1-AP (ZMYM3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ZMYM3 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 25742-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

Synonyms

DXS6673E, KIAA0385, MYM, XFIM, Zinc finger MYM type protein 3

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below
• IP: See 1 publications below

Product Information

25742-1-AP targets ZMYM3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22701

  Product name: Recombinant human ZMYM3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-317 aa of BC013009

  Sequence: MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGPSPSSGALDLLDTPAGLEKDPGVLDGATELLGLGGLLYKAPSPPEVDHGPEGTLAWDAGDQTLEPGPGGQTPEVVPPDPGAGANSCSPEGLLEPLAPDSPITLQSPHIEEEETTSIATARRGSPGQEEELPQGQPQSPNAPPSPSVGETLGDGINSSQTKPGGSSPPAHPSLPGDGLTAKASEKPPERKRSERVRRAEPPKPEVVDSTESIPVSDEDSDAMVDDPNDEDFVPFRPRRSPRMSLRSSVSQRAGRSAVGTKMTCAHCRTP

• Full Name: zinc finger, MYM-type 3
• Calculated Molecular Weight: 1370 aa, 152 kDa
• Observed Molecular Weight: 190-200 kDa
• GenBank Accession Number: BC013009
• Gene Symbol: ZMYM3
• Gene ID (NCBI): 9203
• RRID: AB_2880221
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14202
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZMYM3, also named as DXS6673E, KIAA0385, and ZNF261, is a 1370 amino acid protein, which may be a component of a BHC histone deacetylase complex. ZMYM3 is most abundant in brain, moderate in muscle and heart, low in other tissues except placenta. ZMYM3 plays a role in the regulation of cell morphology and cytoskeletal organization.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP,IHC	Nat Commun; Transposable elements-mediated recruitment of KDM1A epigenetically silences HNF4A expression to promote hepatocellular carcinoma; Authors - Tiantian Jing