ZMYND11 Polyclonal antibody

• 

ZMYND11 Polyclonal Antibody for ELISA

Cat No. 13012-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

BRAM1, BS69, Protein BS69, RP11 486H9.1, ZMYND11

---

Product Information

13012-1-AP targets ZMYND11 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4016

  Product name: Recombinant human ZMYND11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC034784

  Sequence: MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGDSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSM

• Full Name: zinc finger, MYND domain containing 11
• Calculated Molecular Weight: 527 aa, 62 kDa
• GenBank Accession Number: BC034784
• Gene Symbol: ZMYND11
• Gene ID (NCBI): 10771
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15326
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.