ZNF114 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF114 Polyclonal antibody, PBS Only (24974-1-PBS)

• 

  WB analysis of COLO 320 using 24974-1-AP (same clone as 24974-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 24974-1-AP (ZNF114 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24974-1-PBS in a different storage buffer formulation.

ZNF114 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24974-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24974-1-PBS targets ZNF114 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21810

  Product name: Recombinant human ZNF114 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 43-253 aa of BC125069

  Sequence: AFIDWATPCKTKDATPQPDILPKRTFPEANRVCLTSISSQHSTLREDWRCPKTEEPHRQGVNNVKPPAVAPEKDESPVSICEDHEMRNHSKPTCRLVPSQGDSIRQCILTRDSSIFKYNPVLNDSQKTHENNEDDGVLGWNIQWVPCGRKTELKSSTWTGSQNTVHHIRDEIDTGANRHQRNPFGKAFREDGSLRAHNTHGREKMYDFTQC

• Full Name: zinc finger protein 114
• Calculated Molecular Weight: 417 aa, 48 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: BC125069
• Gene Symbol: ZNF114
• Gene ID (NCBI): 163071
• RRID: AB_2879827
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NC26
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.