ZNF132 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF132 Polyclonal antibody, PBS Only (21681-1-PBS)

• 

  WB analysis of mouse heart using 21681-1-AP (same clone as 21681-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 21681-1-AP (ZNF132 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21681-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 21681-1-AP (same clone as 21681-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 21681-1-AP (ZNF132 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21681-1-PBS in a different storage buffer formulation.

ZNF132 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21681-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21681-1-PBS targets ZNF132 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16142

  Product name: Recombinant human ZNF132 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 299-602 aa of BC109107

  Sequence: AFSHSSKLRKHQKFHTEVKYYECIACGKTFNHKLTFVHHQRIHSGERPYECDECGKAFSNRSHLIRHEKVHTGERPFECLKCGRAFSQSSNFLRHQKVHTQVRPYECSQCGKSFSRSSALIQHWRVHTGERPYECSECGRAFNNNSNLAQHQKVHTGERPFECSECGRDFSQSSHLLRHQKVHTGERPFECCDCGKAFSNSSTLIQHQKVHTGQRPYECSECRKSFSRSSSLIQHWRIHTGEKPYECSECGKAFAHSSTLIEHWRVHTKERPYECNECGKFFSQNSILIKHQKVHTGEKPYKCS

• Full Name: zinc finger protein 132
• Calculated Molecular Weight: 706 aa, 81 kDa
• Observed Molecular Weight: 81 and 68 kDa
• GenBank Accession Number: BC109107
• Gene Symbol: ZNF132
• Gene ID (NCBI): 7691
• RRID: AB_2878903
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52740
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF132, also named as Zinc finger protein 132, is a 706 amino-acid protein, which contains 18 C2H2-type zinc fingers and 1 KRAB domain. ZNF132 belongs to the krueppel C2H2-type zinc-finger protein family and localizes in the nucleus. ZNF132 may be involved in transcriptional regulation. ZNF132 exists as two alternatively spliced isoforms, and is encoded by a gene that maps to human chromosome 19.