Tested Applications
| Positive WB detected in | MCF-7 cells, human liver tissue, human testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25515-1-AP targets ZNF134 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22290 Product name: Recombinant human ZNF134 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 96-179 aa of BC042636 Sequence: YQKCYSIEQPLRRDKSEASIVRNCTVSKEPHPSEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCS Predict reactive species |
| Full Name | zinc finger protein 134 |
| Calculated Molecular Weight | 427 aa, 49 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC042636 |
| Gene Symbol | ZNF134 |
| Gene ID (NCBI) | 7693 |
| RRID | AB_2880113 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P52741 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |





