ZNF134 Polyclonal antibody

ZNF134 Polyclonal Antibody for WB, ELISA

Cat No. 25515-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

pHZ 15, zinc finger protein 134, ZNF134

Formulation: PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWB

WB analysis of MCF-7 using 25515-1-AP
MCF-7 cells were subjected to SDS PAGE followed by western blot with 25515-1-AP (ZNF134 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human testis using 25515-1-AP
human testis tissue were subjected to SDS PAGE followed by western blot with 25515-1-AP (ZNF134 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human liver using 25515-1-AP
human liver tissue were subjected to SDS PAGE followed by western blot with 25515-1-AP (ZNF134 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ZNF134 in ?

Overview

Tested Applications
Product Information
Publications (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in

MCF-7 cells, human liver tissue, human testis tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25515-1-AP targets ZNF134 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag22290 Product name: Recombinant human ZNF134 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 96-179 aa of BC042636 Sequence: YQKCYSIEQPLRRDKSEASIVRNCTVSKEPHPSEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCS Predict reactive species
Full Name	zinc finger protein 134
Calculated Molecular Weight	427 aa, 49 kDa
Observed Molecular Weight	50-55 kDa
GenBank Accession Number	BC042636
Gene Symbol	ZNF134
Gene ID (NCBI)	7693
RRID	AB_2880113
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P52741
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ZNF134 Polyclonal antibody (Cat# 25515-1-AP) has 1 total citation. It appears in the Journal of Cell Biology (IF 6.1), published in 2023. The cited study investigates how the outer mitochondrial membrane protein TMEM11 demarcates spatially restricted BNIP3/BNIP3L-mediated mitophagy, placing the research in the fields of mitochondrial biology, mitophagy, and cell biology. The antibody was used in Western blotting on human samples.

Species	Application	Title
human	WB	J Cell Biol The outer mitochondrial membrane protein TMEM11 demarcates spatially restricted BNIP3/BNIP3L-mediated mitophagy Authors - Mehmet Oguz Gok View Article