• Featured Product
  • KD/KO Validated

ZNF148 Recombinant monoclonal antibody, PBS Only

ZNF148 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 84338-7-PBS
Clone No.241632D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

241632D8, BERF 1, BFCOL1, HT BETA, pHZ 52

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84338-7-PBS targets ZNF148 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35742

Product name: Recombinant human ZNF148 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 611-794 aa of BC035591

Sequence: QALDRTSQNDAYLNSPSLNFVTDNQTLPNQPAFSSIDKQVYATMPINSFRSGMNSPLRTTPDKSHFGLIVGDSQHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAGMTSSPDATTGQTFG

Predict reactive species
Full Name zinc finger protein 148
Observed Molecular Weight103 kDa
GenBank Accession NumberBC035591
Gene Symbol ZNF148
Gene ID (NCBI) 7707
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ9UQR1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The Kruppel-like zinc finger protein 148 (ZNF148), also known as β enolase repressor factor 1 (BERF1, ZBP-89, and BFCOL1), encoded by this gene is a member of the Kruppel family of zinc finger DNA binding proteins. ZNF148 participates in the regulation of cell proliferation and death, and is expressed at lower levels in mammalian somatic cells, and highly expressed in tumor cells. Previous studies show that there was a significant correlation between ZNF148 expression and the invasion and metastasis of colorectal tumors. ZNF148 has two alternative splicing isoforms, which are ZNF148FL and ZNF148ΔN. ZNF148FL contains a complete 794 amino acids, ZNF148ΔN lacks the amino-terminal 129 amino acids, and the mechanisms involved in the generation of these two splicing isoforms are not yet clear (PMID: 30463804). Thus, ZNF148 can be observed to have two molecular weights near 103 kDa.

Loading...
||
New chat Able
正在加载,请稍候...