ZNF157 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF157 Polyclonal antibody, PBS Only (33838-1-PBS)

• 

  WB analysis using 33838-1-AP (same clone as 33838-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33838-1-AP (ZNF157 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33838-1-PBS in a different storage buffer formulation.

ZNF157 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33838-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Zinc finger protein 157, Zinc finger protein HZF22

---

Product Information

33838-1-PBS targets ZNF157 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39863

  Product name: Recombinant human ZNF157 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-180 aa of BC075003

  Sequence: MPANGTSPQRFPALIPGEPGRSFEGSVSFEDVAVDFTRQEWHRLDPAQRTMHKDVMLETYSNLASVGLCVAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNGSVGDNALRHDNDLLHHQKIQTLDQNVEYNGCRKAFHEKTGFVRRKRTPRGDKNFECHECGKAYCRKSNLVEH

• Full Name: zinc finger protein 157
• Observed Molecular Weight: 55-65 kDa
• GenBank Accession Number: BC075003
• Gene Symbol: ZNF157
• Gene ID (NCBI): 7712
• RRID: AB_3743087
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P51786
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF157, also known as HZF22, is a zinc finger protein gene located at the X chromosome short arm region 11.3. As a member of the zinc finger protein family, ZNF157 primarily functions through its C2H2-type zinc finger domain. This domain enables ZNF157 to bind to DNA, thereby playing a key role in the regulation of gene expression.