ZNF169 Polyclonal antibody

• 

  WB analysis of mouse small intestine using 26344-1-AP

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 26344-1-AP (ZNF169 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 26344-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26344-1-AP (ZNF169 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 26344-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 26344-1-AP (ZNF169 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 26344-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26344-1-AP (ZNF169 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 26344-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 26344-1-AP (ZNF169 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

ZNF169 Polyclonal Antibody for WB, ELISA

Cat No. 26344-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

zinc finger protein 169, ZNF169

---

Tested Applications

• Positive WB detected in: mouse small intestine tissue, HeLa cells, HepG2 cells, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26344-1-AP targets ZNF169 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23805

  Product name: Recombinant human ZNF169 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 64-200 aa of BC047702

  Sequence: NEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQYALSGHPTQIFPSSSAGGDFQLEAPRCSSEKGESGETEGPDSSLRKRPSRISRTFFSPHQGDPVEWVEGNREGGTDLRLAQRMSLGGSDTMLKGADTSESGAVI

• Full Name: zinc finger protein 169
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC047702
• Gene Symbol: ZNF169
• Gene ID (NCBI): 169841
• RRID: AB_2880484
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14929
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZNF169 (Zinc finger protein 169) is a 603 amino acid nuclear protein that contains one KRAB domain and thirteen C2H2-type zinc fingers. ZNF169 is highly expressed in kidney and weakly expressed in spleen, liver, small intestine and heart, where it functions as a transcription regulator.