ZNF184 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF184 Polyclonal antibody (26100-1-AP)

ZNF184 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 26100-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF/ICC, IP, ELISA

Synonyms

kr-ZNF3

• 

  WB analysis using 26100-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26100-1-AP (ZNF184 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 26100-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26100-1-AP (ZNF184 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 26100-1-AP

  HCT 116 cells were subjected to SDS PAGE followed by western blot with 26100-1-AP (ZNF184 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 26100-1-AP

  Immunofluorescent analysis of HepG2 cells using 26100-1-AP (ZNF184 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ZNF184 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HCT 116 cells, HepG2 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26100-1-AP targets ZNF184 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23314

  Product name: Recombinant human ZNF184 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-205 aa of BC022992

  Sequence: MEDLSSPDSTLLQGGHNLLSSASFQESVTFKDVIVDFTQEEWKQLDPGQRDLFRDVTLENYTHLVSIGLQVSKPDVISQLEQGTEPWIMEPSIPVGTCADWETRLENSVSAPEPDISEEELSPEVIVEKHKRDDSWSSNLLESWEYEGSLERQQANQQTLPKEIKVTEKTIPSWEKGPVNNEFGKSVNVSSNLVTQEPSPEETST

• Full Name: zinc finger protein 184
• Calculated Molecular Weight: 86 kDa
• Observed Molecular Weight: 86 kDa
• GenBank Accession Number: BC022992
• Gene Symbol: ZNF184
• Gene ID (NCBI): 7738
• RRID: AB_2880376
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99676
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Anti-ZNF184 antibody (Cat# 26100-1-AP) has 3 total citations. They appear in Nucleic Acids Research (IF 15), Molecular Carcinogenesis (IF 3.5), and PLoS One (IF 2.8). Associated research fields include DNA repair and acute lymphoblastic leukemia prognosis, stemness-associated paclitaxel resistance in breast cancer, and α-synuclein-mediated neurodegeneration in mouse and human models.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP,IF	Nucleic Acids Res; ZNF184 negatively regulates HR repair and predicts poor prognosis in acute lymphoblastic leukemia.; Authors - Won Chan Hwang ; KO Validated
		Mol Carcinog; Integrated Analysis Reveals ZNF184 as a Novel Regulator of Stemness-Associated Paclitaxel Resistance and Tumor Progression in Breast Cancer.; Authors - Rong Gong
mouse,human	WB	PLoS One; Zinc finger protein 184 prevents α-synuclein preformed fibril-mediated neurodegeneration through the interleukin enhancer binding factor 3-microRNA-7 pathway; Authors - Jihye Kim ; KD Validated