ZNF202 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF202 Polyclonal antibody, PBS Only (26216-1-PBS)

• 

  WB analysis using 26216-1-AP (same clone as 26216-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26216-1-AP (ZNF202 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26216-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26216-1-AP (same clone as 26216-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26216-1-AP (ZNF202 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26216-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse spermatophore using 26216-1-AP (same clone as 26216-1-PBS)

  mouse spermatophore tissue were subjected to SDS PAGE followed by western blot with 26216-1-AP (ZNF202 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26216-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 26216-1-AP (same clone as 26216-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 26216-1-AP (ZNF202 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26216-1-PBS in a different storage buffer formulation.

ZNF202 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 26216-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

26216-1-PBS targets ZNF202 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23859

  Product name: Recombinant human ZNF202 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 239-416 aa of BC013382

  Sequence: FKDVAVCFSQDQWSDLDPTQKEFYGEYVLEEDCGIVVSLSFPIPRPDEISQVREEEPWVPDIQEPQETQEPEILSFTYTGDRSKDEEECLEQEDLSLEDIHRPVLGEPEIHQTPDWEIVFEDNPGRLNERRFGTNISQVNSFVNLRETTPVHPLLGRHHDCSVCGKSFTCNSHLVRHL

• Full Name: zinc finger protein 202
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC013382
• Gene Symbol: ZNF202
• Gene ID (NCBI): 7753
• RRID: AB_3669529
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95125
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF202 gene product is a transcriptional repressor that binds to elements found predominantly in genes that participate in lipid metabolism. Among its targets are structural components of lipoprotein particles (apolipoproteins AIV, CIII, and E), enzymes involved in lipid processing (lipoprotein lipase, lecithin cholesteryl ester transferase), and several genes involved in processes related to energy metabolism and vascular disease (PMID: 10748193). ZNF202 is expressed in two common splice variants. The α protein consists of 424 amino acids, while the β-protein consists of 648 amino acids (PMID: 11279031).