ZNF207 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ZNF207 Recombinant monoclonal antibody, PBS Only (87649-1-PBS)

• 

  WB analysis using 87649-1-RR (same clone as 87649-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87649-1-RR (ZNF207 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87649-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87649-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87649-1-RR against Human ZNF207 were performed. The affinity constant is 0.478 nM.

ZNF207 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87649-1-PBS

Clone No.253049C10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

BUB3-interacting and GLEBS motif-containing protein ZNF207, BuGZ, hBuGZ, Zinc finger protein 207

---

Product Information

87649-1-PBS targets ZNF207 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag40360

  Product name: Recombinant human ZNF207 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 114-463 aa of BC002372

  Sequence: DEYDDDDSAASTSFQPQPVQPQQGYIPPMAQPGLPPVPGAPGMPPGIPPLMPGVPPLMPGMPPVMPGMPPGLHHQRKYTQSFCGENIMMPMGGMMPPGPGIPPLMPGMPPGMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPTATVPAPQPPVTKPLFPSAGQAQAAVQGPVGTDFKPLNSTPATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQGGRY

• Full Name: zinc finger protein 207
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 50-57 kDa
• GenBank Accession Number: BC002372
• Gene Symbol: ZNF207
• Gene ID (NCBI): 7756
• RRID: AB_3745675
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43670
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.