• Featured Product
  • KD/KO Validated

ZNF217 Recombinant monoclonal antibody, PBS Only (Capture)

ZNF217 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84276-1-PBS
Clone No.241217E3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA, Sample test

ZFP217, 241217E3, ZABC1, Zinc finger protein 217

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84276-1-PBS targets ZNF217 as part of a matched antibody pair:

MP01357-1: 84276-1-PBS capture and 84276-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag19453

Product name: Recombinant human ZNF217 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 707-1043 aa of BC113427

Sequence: IPSITCPFCTFKTFYPEVLMMHQRLEHKYNPDVHKNCRNKSLLRSRRTGCPPALLGKDVPPLSSFCKPKPKSAFPAQSKSLPSAKGKQSPPGPGKAPLTSGIDSSTLAPSNLKSHRPQQNVGVQGAATRQQQSEMFPKTSVSPAPDKTKRPETKLKPLPVAPSQPTLGSSNINGSIDYPAKNDSPWAPPGRDYFCNRSASNTAAEFGEPLPKRLKSSVVALDVDQPGANYRRGYDLPKYHMVRGITSLLPQDCVYPSQALPPKPRFLSSSEVDSPNVLTVQKPYGGSGPLYTCVPAGSPASSSTLEGKRPVSYQHLSNSMAQKRNYENFIGNAHYRP

Predict reactive species
Full Name zinc finger protein 217
Calculated Molecular Weight 1048 aa, 115 kDa
Observed Molecular Weight~ 130 kDa
GenBank Accession NumberBC113427
Gene Symbol ZNF217
Gene ID (NCBI) 7764
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDO75362
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Zinc finger protein 217 (ZNF217) is a member of the Krüppel-like factor transcription factor family. ZNF217 possesses a characteristic structure of zinc finger motifs and plays a crucial role in regulating the biological activities of cells. ZNF217 binds to DNA through its zinc fingers thereby targeting potential protein binding partners to specific sites in the genome. Recent findings have revealed that ZNF217 is strongly associated with multiple aspects of cancer progression, impacting patient prognosis. PMID: 38259608

Loading...
||
New chat Able
正在加载,请稍候...