ZNF23 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF23 Polyclonal antibody, PBS Only (21322-1-PBS)

• 

  WB analysis of HepG2 using 21322-1-AP (same clone as 21322-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21322-1-AP (ZNF23 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21322-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 21322-1-AP (same clone as 21322-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21322-1-AP (ZNF23 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21322-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 21322-1-AP (same clone as 21322-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 21322-1-AP (ZNF23 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21322-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 21322-1-AP (same clone as 21322-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 21322-1-AP (ZNF23 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21322-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A2780 using 21322-1-AP (same clone as 21322-1-PBS)

  A2780 cells were subjected to SDS PAGE followed by western blot with 21322-1-AP (ZNF23 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21322-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse spleen using 21322-1-AP (same clone as 21322-1-PBS)

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 21322-1-AP (ZNF23 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21322-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A2780 using 21322-1-AP (same clone as 21322-1-PBS)

  A2780 cells were subjected to SDS PAGE followed by western blot with 21322-1-AP (ZNF23 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21322-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SKOV-3 using 21322-1-AP (same clone as 21322-1-PBS)

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 21322-1-AP (ZNF23 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21322-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 21322-1-AP (same clone as 21322-1-PBS)

  IP result of anti-ZNF23 (IP:21322-1-AP, 4ug; Detection:21322-1-AP 1:800) with mouse brain tissue lysate 4000ug. This data was developed using the same antibody clone with 21322-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 21322-1-AP (same clone as 21322-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using ZNF23 antibody 21322-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 21322-1-PBS in a different storage buffer formulation.

ZNF23 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 21322-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

KOX16, Zfp612, Zinc finger protein 23, Zinc finger protein 359, Zinc finger protein 612

---

Product Information

21322-1-PBS targets ZNF23 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14755

  Product name: Recombinant human ZNF23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 294-643 aa of BC007256

  Sequence: AYITHQRVHTGEKPYECNDCGKAFNVNAKLIQHQRIHTGEKPYECNECGKGFRCSSQLRQHQSIHTGEKPYQCKECGKGFNNNTKLIQHQRIHTGEKPYECTECGKAFSVKGKLIQHQRIHTGEKPYECNECGKAFRCNSQFRQHLRIHTGEKPYECNECGKAFSVNGKLMRHQRIHTGEKPFECNECGRCFTSKRNLLDHHRIHTGEKPYQCKECGKAFSINAKLTRHQRIHTGEKPFKCMECEKAFSCSSNYIVHQRIHTGEKPFQCKECGKAFHVNAHLIRHQRSHTGEKPFRCVECGKGFSFSSDYIIHQTVHTWKKPYMCSVCGKAFRFSFQLSQHQSVHSEGKS

• Full Name: zinc finger protein 23 (KOX 16)
• Calculated Molecular Weight: 643 aa, 73 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: BC007256
• Gene Symbol: ZNF23
• Gene ID (NCBI): 7571
• RRID: AB_2878839
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17027
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.