ZNF230 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF230 Polyclonal antibody, PBS Only (21198-1-PBS)

• 

  WB analysis using 21198-1-AP (same clone as 21198-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21198-1-AP (ZNF230 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21198-1-PBS in a different storage buffer formulation.

ZNF230 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21198-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21198-1-PBS targets ZNF230 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15551

  Product name: Recombinant human ZNF230 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 125-474 aa of BC050340

  Sequence: QVEAGLSIIHTGQKPSQNGKCKQSFSDVAIFDPPQQFHSGEKSHTCNECGKSFCYISALRIHQRVHLREKLSKCDMRGKEFSQSSCLQTRERVHTGEKPFKCEQCGKGFRCRAILQVHCKLHTGEKPYICEKCGRAFIHDFQLQKHQIIHTGEKPFKCEICGKSFCLRSSLNRHCMVHTAEKLYKSEECGKGFTDSLDLHKHQIIHTGQKPYNCKECGKSFRWSSYLLIHQRIHSGEKPYRCEECGKGYISKSGLNLHQRVHTGERPYNCKECGKSFSRASSILNHKKLHCRKKPFKCEDCGKRLVHRSFCKDQQGDHNGENSSKCEDCGKRYKRRLNLDIILSLFLNDM

• Full Name: zinc finger protein 230
• Calculated Molecular Weight: 474 aa, 55 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC050340
• Gene Symbol: ZNF230
• Gene ID (NCBI): 7773
• RRID: AB_3085643
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UIE0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.