ZNF232 Polyclonal antibody

• 

  WB analysis of PC-3 using 21467-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 21467-1-AP (ZNF232 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 21467-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21467-1-AP (ZNF232 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

ZNF232 Polyclonal Antibody for WB, ELISA

Cat No. 21467-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

zinc finger protein 232, ZNF232, ZSCAN11

---

Tested Applications

• Positive WB detected in: PC-3 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21467-1-AP targets ZNF232 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15105

  Product name: Recombinant human ZNF232 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 95-445 aa of BC016039

  Sequence: EALSQLRVLCCEWLRPEKHTKEQILEFLVLEQFLTILPEELQSWVRGHHPKSGEEAVTVLEDLEKGLEPEPQVPGPAHGPAQEEPWEKKESLGAAQEALSIQLQPKETQPFPKSEQVYLHFLSVVTEDGPEPKDKGSLPQPPITEVESQVFSEKLATDTSTFEATSEGTLELQQRNPKAERLRWSPAQEESFRQMVVIHKEIPTGKKDHECSECGKTFIYNSHLVVHQRVHSGEKPYKCSDCGKTFKQSSNLGQHQRIHTGEKPFECNECGKAFRWGAHLVQHQRIHSGEKPYECNECGKAFSQSSYLSQHRRIHSGEKPFICKECGKAYGWCSELIRHRRVHARKEPSH

• Full Name: zinc finger protein 232
• Calculated Molecular Weight: 444 aa, 51 kDa
• Observed Molecular Weight: 48-51 kDa
• GenBank Accession Number: BC016039
• Gene Symbol: ZNF232
• Gene ID (NCBI): 7775
• RRID: AB_2878864
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UNY5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.