ZNF284 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF284 Polyclonal antibody, PBS Only (24681-1-PBS)

• 

  WB analysis of mouse liver using 24681-1-AP (same clone as 24681-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 24681-1-AP (ZNF284 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24681-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 24681-1-AP (same clone as 24681-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 24681-1-AP (ZNF284 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24681-1-PBS in a different storage buffer formulation.

ZNF284 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24681-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24681-1-PBS targets ZNF284 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20336

  Product name: Recombinant human ZNF284 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 519-593 aa of BC156663

  Sequence: GFRWASTHLTHQRLHSREKLFQCEDCGKSSEHSSCLQDQQSDHSGEKTSKCEDCGKRYERRLNLDMILSLFLNDI

• Full Name: zinc finger protein 284
• Calculated Molecular Weight: 593 aa, 69 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC156663
• Gene Symbol: ZNF284
• Gene ID (NCBI): 342909
• RRID: AB_2879670
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2VY69
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.