ZNF322A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF322A Polyclonal antibody, PBS Only (25635-1-PBS)

• 

  WB analysis using 25635-1-AP (same clone as 25635-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25635-1-AP (ZNF322A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25635-1-PBS in a different storage buffer formulation.

ZNF322A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25635-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

HCG12, ZNF322, ZNF388, ZNF489

---

Product Information

25635-1-PBS targets ZNF322A in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22406

  Product name: Recombinant human ZNF322A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 320-402 aa of BC050425

  Sequence: PHQWSACESGFLLGMDFVAQQKMRTQTEELHYKYTVCDKSFHQSSALLQHQTVHIGEKPFVCNVSEKGLELSPPHASEASQMS

• Full Name: zinc finger protein 322A
• Calculated Molecular Weight: 402 aa, 47 kDa
• Observed Molecular Weight: 46-52 kDa
• GenBank Accession Number: BC050425
• Gene Symbol: ZNF322A
• Gene ID (NCBI): 79692
• RRID: AB_3669490
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6U7Q0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Zinc finger protein ZNF322A is an oncogenic transcription factor. Overexpression of ZNF322A activates pro-metastasis, cancer stemness, and neo-angiogenesis-related genes to enhance lung cancer progression.