ZNF350 Recombinant monoclonal antibody

• 

  WB analysis of THP-1 using 84121-5-RR

  THP-1 cells were subjected to SDS PAGE followed by western blot with 84121-5-RR (ZNF350 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of A431 using 84121-5-RR

  1x10^6 A431 cells were intracellularly stained with 0.25 ug ZNF350 Recombinant antibody (84121-5-RR, Clone:241225D5) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 84121-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84121-5-RR against Human ZNF350 were performed. The affinity constant is below 1 pM.

ZNF350 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 84121-5-RR

Clone No.241225D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

241225D5, KRAB zinc finger protein ZFQR, ZBRK1, ZFQR, zinc finger protein 350

---

Tested Applications

• Positive WB detected in: THP-1 cells
• Positive FC (Intra) detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84121-5-RR targets ZNF350 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag23982

  Product name: Recombinant human ZNF350 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 426-532 aa of BC009921

  Sequence: REKQEAAKVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLANRNVVLVGQPVVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYVLFYVTENP

• Full Name: zinc finger protein 350
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC009921
• Gene Symbol: ZNF350
• Gene ID (NCBI): 59348
• RRID: AB_3671683
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9GZX5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZNF350 (Zinc finger protein 350), also known as zinc-finger and BRCA1-interacting protein with a Kruppel-associated box (KRAB) domain (ZBRK1), is involved in the development of several human tumor types, including breast, colon, and cervical carcinomas. ZNF350 has been identified as a transcriptional suppressor that can either form complexes with other proteins or play a direct transcriptional suppressive role in a single-factor form (PMID: 30613364). Overexpression of ZBRK1 has the potential to inhibit cancer cell migration and suppress metastasis activity suggesting that ZBRK1 may behave as a metastasis suppressor (PMID: 19996286).