ZNF365 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF365 Polyclonal antibody (33051-1-AP)

• 

  WB analysis using 33051-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33051-1-AP (ZNF365 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

ZNF365 Polyclonal Antibody for WB, ELISA

Cat No. 33051-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

DBZ, DISC1-binding zinc-finger protein, KIAA0844, Protein su48, Protein ZNF365

---

Tested Applications

• Positive WB detected in: HepG2 cells, Jurkat cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33051-1-AP targets ZNF365 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37654

  Product name: Recombinant human ZNF365 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 132-407 aa of BC070073

  Sequence: MDLHADSLDGTRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTVEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMIAVLRQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGFVRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKSHFHPKGRNHLKKAKDDRASMQPAKAIHEQAESSRDLCRPPKKGELLGFGRKGNIRPKMAKKKPTAIVNII

• Full Name: zinc finger protein 365
• Calculated Molecular Weight: 407 aa, 46 kDa
• Observed Molecular Weight: 52 kDa, 46kDa
• GenBank Accession Number: BC070073
• Gene Symbol: ZNF365
• Gene ID (NCBI): 22891
• RRID: AB_3742838
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q70YC5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZNF365 is a direct p53 target that promotes genome stability. Germline polymorphisms in the ZNF365 locus are associated with increased cancer risk, including those associated with telomere dysfunction. On the mechanistic level, ZNF365 suppresses expression of a subset of common fragile sites, including telomeres. In the absence of ZNF365, defective telomeres engage in aberrant recombination of telomere ends, leading to increased telomere sister chromatid exchange and formation of anaphase DNA bridges, including ultra-fine DNA bridges, and ultimately increased cytokinesis failure and aneuploidy (PMID: 23776040).