ZNF366 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF366 Polyclonal antibody (24340-1-AP)

ZNF366 Polyclonal Antibody for WB, ELISA

Cat No. 24340-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

DCSCRIPT, DC-SCRIPT, Dendritic cell-specific transcript protein

• 

  WB analysis using 24340-1-AP

  Mouse skeletal muscle tissue was subjected to SDS PAGE followed by western blot with 24340-1-AP (ZNF366 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 24340-1-AP

  Mouse heart tissue was subjected to SDS PAGE followed by western blot with 24340-1-AP (ZNF366 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ZNF366 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24340-1-AP targets ZNF366 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19591

  Product name: Recombinant human ZNF366 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 558-744 aa of BC121053

  Sequence: VMERGLHSQGLGRGRIALAQTAGVLRSLEQEEPFDLSQKRRAKVPVFQSDGESAQGSHCHEEEEEDNCYEVEPYSPGLAPQSQQLCTPEDLSTKSEHAPEVLEEACKEEKEDASKGEWEKRSKGDLGAEGGQERDCAGRDECLSLRAFQSTRRGPSFSDYLYFKHRDESLKELLERKMEKQAVLLGI

• Full Name: zinc finger protein 366
• Calculated Molecular Weight: 744 aa, 85 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: BC121053
• Gene Symbol: ZNF366
• Gene ID (NCBI): 167465
• RRID: AB_2879500
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N895
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ZNF366 Polyclonal antibody (Cat# 24340-1-AP) has 1 citation. It was cited in Cell Reports in Medicine (2026), in a study using CRISPR activation to identify transcription factors that reprogram glioblastoma into dendritic cell-like cells, eliciting systemic antitumor immunity. The antibody was applied for Western blot in human and mouse samples. The research field encompasses neuro-oncology, tumor immunology, and cell reprogramming.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human, mouse	WB	Cell Rep Med; CRISPRa-identified transcription factors reprogram glioblastoma into dendritic cell-like cells to elicit systemic antitumor immunity.; Authors - Xiao Liu