ZNF385A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF385A Polyclonal antibody (26288-1-AP)

• Featured Product
• KD/KO Validated

ZNF385A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26288-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ZNF385, Zinc finger protein 385A, ZFP385

• 

  WB analysis of HeLa using 26288-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26288-1-AP (ZNF385A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brown disease using 26288-1-AP

  Immunohistochemical analysis of paraffin-embedded human brown disease slide using 26288-1-AP (ZNF385A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brown disease using 26288-1-AP

  Immunohistochemical analysis of paraffin-embedded human brown disease slide using 26288-1-AP (ZNF385A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HaCaT using 26288-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HaCaT cells using ZNF385A antibody (26288-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ZNF385A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: human brown disease; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HaCaT cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26288-1-AP targets ZNF385A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23577

  Product name: Recombinant human ZNF385A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 76-172 aa of BC029752

  Sequence: NRHARRVKGIEAAKTRGREPGVREPGDPAPPGSTPTNGDGVAPRPVSMENGLGPAPGSPEKQPGSPSPPSIPETGQGVTKGEGGTPAPASLPGGSKE

• Full Name: zinc finger protein 385A
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC029752
• Gene Symbol: ZNF385A
• Gene ID (NCBI): 25946
• RRID: AB_2880464
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PM9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ZNF385A antibody (Cat# 26288-1-AP) has 3 total citations published in Nature Communications, International Journal of Molecular Sciences, and Journal of Proteome Research. The associated research fields include dsRNA homeostasis regulation, prognostic biomarkers in hepatocellular carcinoma tumor microenvironment, and miRNA-mediated suppression of cervical cancer. Applications cited include Western blot, immunofluorescence, and immunohistochemistry in human and mouse samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Nat Commun; Characterization of dsRNA binding proteins through solubility analysis identifies ZNF385A as a dsRNA homeostasis regulator; Authors - Na Jiang ; KD Validated
human	WB	Int J Mol Sci; ZNF385A and ZNF346 Serve as Prognostic Biomarkers Associated with an Inflamed Immunosuppressive Tumor Microenvironment in Hepatocellular Carcinoma; Authors - Qihang Peng ; KD Validated
human,mouse	WB,IHC	J Proteome Res; Quantitative Proteomics Reveal the Mechanism of MiR-138-5p Suppressing Cervical Cancer via Targeting ZNF385A; Authors - Qihang Peng ; KD Validated