Filter: AllWB

WB analysis of mouse kidney using 20806-1-AP (same clone as 20806-1-PBS)
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 20806-1-AP (ZNF385D antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20806-1-PBS in a different storage buffer formulation.
WB analysis of human testis using 20806-1-AP (same clone as 20806-1-PBS)
human testis tissue were subjected to SDS PAGE followed by western blot with 20806-1-AP (ZNF385D antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20806-1-PBS in a different storage buffer formulation.

ZNF385D Polyclonal antibody, PBS Only

ZNF385D Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20806-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

20806-1-PBS targets ZNF385D in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag14746 Product name: Recombinant human ZNF385D protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 105-198 aa of BC007212 Sequence: AKKLKALEAMKNKQKSVTAKDSAKTTFTSITTNTINTSSDKTDGTAGTPAISTTTTVEIRKSSVMTTEITSKVEKSPTTATGNSSCPSTETEEE Predict reactive species
Full Name	zinc finger protein 385D
Calculated Molecular Weight	395 aa, 42 kDa
Observed Molecular Weight	42 kDa
GenBank Accession Number	BC007212
Gene Symbol	ZNF385D
Gene ID (NCBI)	79750
RRID	AB_10696185
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9H6B1
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™