ZNF391 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF391 Polyclonal antibody, PBS Only (24805-1-PBS)

• 

  IP experiment of mouse testis using 24805-1-AP (same clone as 24805-1-PBS)

  IP result of anti-ZNF391 (IP:24805-1-AP, 3ug; Detection:24805-1-AP 1:300) with mouse testis tissue lysate 4000ug. This data was developed using the same antibody clone with 24805-1-PBS in a different storage buffer formulation.

ZNF391 Polyclonal Antibody for IP, Indirect ELISA

Cat No. 24805-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IP, Indirect ELISA

Synonyms

---

Product Information

24805-1-PBS targets ZNF391 in IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20317

  Product name: Recombinant human ZNF391 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-128 aa of BC156667

  Sequence: MESLRGNTAQGPTNEEDYKNEGQLSRQTKCPAQKKSSFENTVVRKVSVTLKEIFTGEEGPESSEFSLSPNLDAQQKIPKGHGSPISRKNSKDNSDLIKHQRLFSQRKPCKCNECEKAFSYQSDLLVHS

• Full Name: zinc finger protein 391
• Calculated Molecular Weight: 3588 aa, 41 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC156667
• Gene Symbol: ZNF391
• Gene ID (NCBI): 346157
• RRID: AB_2879736
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UJN7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF391 is involved in transcriptional regulation. The calculated MW of ZFN391 is 358aa, 41 kDa. The immunogen of this antibody is 1-128aa of human ZNF391. No other protein can be recognized by this antibody from the sequence BLAST results.