ZNF404 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF404 Polyclonal antibody (21592-1-AP)

• 

  WB analysis using 21592-1-AP

  Mouse brain tissue were subjected to SDS PAGE followed by western blot with 21592-1-AP (ZNF404 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

ZNF404 Polyclonal Antibody for WB, ELISA

Cat No. 21592-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

zinc finger protein 404

---

Tested Applications

• Positive WB detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21592-1-AP targets ZNF404 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16166

  Product name: Recombinant human ZNF404 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 45-271 aa of BC101333

  Sequence: LDFNFTTESNKLSSEKRNYEVNAYHQETWKRNKTFNLMRFIFRTDPQYTIEFGRQQRPKVGCFSQMIFKKHKSLPLHKRNNTREKSYECKEYKKGFRKYLHLTEHLRDHTGVIPYECNECGKAFVVFQHFIRHRKIHTDLKPYECNGCEKAFRFYSQLIQHQIIHTGMKPYECKQCGKAFRRHSHLTEHQKIHVGLKPFECKECGETFRLYRHMCLHQKIHHGVKPY

• Full Name: zinc finger protein 404
• Calculated Molecular Weight: 552 aa, 65 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC101333
• Gene Symbol: ZNF404
• Gene ID (NCBI): 342908
• RRID: AB_3742045
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q494X3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZNF404 (Zinc Finger Protein 404) is a putative transcription factor belonging to the Krüppel-associated box (KRAB) zinc finger protein (KZFP) family. ZNF404 is predicted to function as a DNA-binding transcription factor that regulates RNA polymerase II-mediated transcription, potentially acting as a transcriptional repressor.