ZNF446 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF446 Polyclonal antibody (16218-1-AP)

ZNF446 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 16218-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

ZSCAN30, ZKSCAN20

• 

  WB analysis of SH-SY5Y using 16218-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 16218-1-AP (ZNF446 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 16218-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 16218-1-AP (ZNF446 Antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SH-SY5Y using 16218-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed SH-SY5Y cells using 16218-1-AP (ZNF446 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ZNF446 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16218-1-AP targets ZNF446 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9266

  Product name: Recombinant human ZNF446 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 72-422 aa of BC017206

  Sequence: EQFLGTLPPEIQAWVRGQRPGSPEEAAALVEGLQHDPGQLLGWITAHVLKQEVLPAAQKTEEPLGSPHPSGTVESPGEGPQDTRIEGSVQLSCSVKEEPNVDGQEVAPSSPPLAAQSPEGHHGHQEPASTSFHPPRIQEEWGLLDRSQKELYWDAMLEKYGTVVSLGLPPHQPEAQAQSELGMLLTGTGVCRSLRSGNESEGPPGCPEAQPPQGPGPAAWEGLSGAATPAPTVRPGTPPVPTQPTPAETRLEPAATPRKPYTCEQCGRGFDWKSVFVIHHRTHTSGPGVQSPGLATGESTEKPPQGEVAFPHHPRHSLTGPRSYPCEECGCSFSWKSQLVIHRKSHRPEVP

• Full Name: zinc finger protein 446
• Calculated Molecular Weight: 422 aa, 46 kDa
• Observed Molecular Weight: 49-55 kDa
• GenBank Accession Number: BC017206
• Gene Symbol: ZNF446
• Gene ID (NCBI): 55663
• RRID: AB_2878231
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NWS9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ZNF446 Polyclonal antibody (Cat# 16218-1-AP) has 1 total citation. It appears in the journal eLife (2020), in a study investigating ZNF165 as a SMAD3 cofactor coordinating oncogenic TGFβ signaling in triple-negative breast cancer. The associated research field is cancer biology, specifically TGFβ signaling pathway and breast cancer. The antibody was used for Western blot in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Elife; The testis protein ZNF165 is a SMAD3 cofactor that coordinates oncogenic TGFβ signaling in triple-negative breast cancer.; Authors - Zane A Gibbs