ZNF462 Polyclonal antibody

• 

  WB analysis using 23793-1-AP

  Mouse retina tissue lysates were subjected to SDS PAGE followed by western blot with 23793-1-AP (ZNF462 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse eye using 23793-1-AP

  IP result of anti-ZNF462 (IP:23793-1-AP, 4ug; Detection:23793-1-AP 1:500) with mouse eye tissue lysate 3600 ug.

ZNF462 Polyclonal Antibody for WB, IP, ELISA

Cat No. 23793-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

Synonyms

Zfp462, ZFPIP, Zinc finger PBX1-interacting protein

---

Tested Applications

• Positive WB detected in: mouse retina tissue
• Positive IP detected in: mouse eye tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23793-1-AP targets ZNF462 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20699

  Product name: Recombinant human ZNF462 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2157-2506 aa of BC036884

  Sequence: NHYQSAALARNNSRVSPVPLSGAAAGTEQKTEAVLHCEFCEFSSGYIQSIRRHYRDKHGGKKLFKCKDCSFYTGFKSAFTMHVEAGHSAVPEEGPKDLRCPLCLYHTKYKRNMIDHIVLHREERVVPIEVCRSKLSKYLQGVVFRCDKCTFTCSSDESLQQHIEKHNELKPYKCQLCYYETKHTEELDSHLRDEHKVSRNFELVGRVNLDQLEQMKEKMESSSSDDEDKEEEMNSKAEDRELMRFSDHGAALNTEKRFPCEFCGRAFSQGSEWERHVLRHGMALNDTKQVSREEIHPKEIMENSVKMPSIEEKEDDEAIGIDFSLKNETVAICVVTADKSLLENAEAKKE

• Full Name: zinc finger protein 462
• Calculated Molecular Weight: 2506 aa, 285 kDa
• Observed Molecular Weight: 285 kDa
• GenBank Accession Number: BC036884
• Gene Symbol: ZNF462
• Gene ID (NCBI): 58499
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q96JM2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.