ZNF467 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF467 Polyclonal antibody, PBS Only (31411-1-PBS)

• 

  WB analysis using 31411-1-AP (same clone as 31411-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31411-1-AP (ZNF467 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31411-1-PBS in a different storage buffer formulation.

ZNF467 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31411-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EZI, Zfp467, zinc finger protein 467

---

Product Information

31411-1-PBS targets ZNF467 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35758

  Product name: Recombinant human ZNF467 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-234 aa of NM_207336.2

  Sequence: MRETLEALSSLGFSVGQPEMAPQSEPREGSHNAQEQMSSSREERALGVCSGHEAPTPEEGAHTEQAEAPCRGQACSAQKAQPVGTCPGEEWMIRKVKVEDEDQEAEEEVEWPQHLSLLPSPFPAPDLGHLAAAYKLEPGAPGALSGLALSGWGPMPEKPYGCGECERRFRDQLTLRLHQRLHRGEGPCACPDCGRSFTQRAHMLLHQRSHRGERPFPCSECDKRFSKKAHLTRH

• Full Name: zinc finger protein 467
• Calculated Molecular Weight: 65kDa，595aa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: NM_207336.2
• Gene Symbol: ZNF467
• Gene ID (NCBI): 168544
• RRID: AB_3669971
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7Z7K2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Zinc finger protein 467 (ZNF467) is a transcription factor that promotes adipocyte differentiation and suppresses osteoblast differentiation in the bone marrow. It has 595 amino acids with a molecular mass of 65 kDa.