ZNF485 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF485 Polyclonal antibody (21083-1-AP)

• 

  IF Staining of HEK-293 using 21083-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using ZNF485 antibody (21083-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

ZNF485 Polyclonal Antibody for IF/ICC, ELISA

Cat No. 21083-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, ELISA

Synonyms

zinc finger protein 485

---

Tested Applications

• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21083-1-AP targets ZNF485 in IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15297

  Product name: Recombinant human ZNF485 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 53-402 aa of BC014161

  Sequence: MSALKQSTSEASVLGERTKSVMMEKGLDWEGRSSTEKNYKCKECGKVFKYNSSFISHQRNHTSEKPHKCKECGIAFMNSSSLLNHHKVHAGKQPYRCIECGKFLKKHSTFINHQRIHSREKPHKCIECGKTFRKNSILLSHQRIHTGQKPYKCNDCGKAFAQNAALTRHERIHSGEKPFKCNKCGRAFRDNSTVLEHQKIHTGEKPYQCNECGKAFRKSSTLISHQRMHTGEKPYHCSKCGKSFRYSSSFAGHQKTHSGNKPYQCRDCGKAFTKSSTLTGHQRIHTGEKPYHCKKCGKAFRHSSGLVEHQRLHTGEKPYKCNECGKAFPRSSALKQHKKIHNKERAMKCS

• Full Name: zinc finger protein 485
• Calculated Molecular Weight: 441 aa, 50 kDa
• GenBank Accession Number: BC014161
• Gene Symbol: ZNF485
• Gene ID (NCBI): 220992
• RRID: AB_3742015
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NCK3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZNF485 is predicted to function as a transcription factor involved in the regulation of gene expression . It is believed to enable sequence-specific double-stranded DNA binding and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. (PMID: 38993359)