ZNF486 Polyclonal antibody

• 

  WB analysis of COLO 320 using 20599-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 20599-1-AP (ZNF486 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

ZNF486 Polyclonal Antibody for WB, ELISA

Cat No. 20599-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

HCG1999761, isoform CRA_b, KRBO2, zinc finger protein 486, ZNF486

---

Tested Applications

• Positive WB detected in: COLO 320 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20599-1-AP targets ZNF486 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14567

  Product name: Recombinant human ZNF486 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 43-259 aa of BC008936

  Sequence: MESLQFRDVAVEFSLEEWHCLDTAQQNLYRDVMLENYRHLVFLGIIVSKPDLITCLEQGIKPLTMKRHEMIAKPPVVCSHFAQDLWPEQSIKDSYQKVILRKFEKCGHGNLHFKKGCESVDECKLHKRGYNGLNQCLTTTQSKIFQCGKYVKVFHQFSNSKRHKRRHTEKKPLKYIEGDKAFNQSSTHTTHKKIDTGEKPYKCEECGKAFNRSSCL

• Full Name: zinc finger protein 486
• Calculated Molecular Weight: 463 aa, 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC008936
• Gene Symbol: ZNF486
• Gene ID (NCBI): 90649
• RRID: AB_2878707
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96H40
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.