ZNF496 Polyclonal antibody

• 

  WB analysis using 20900-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20900-1-AP (ZNF496 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 20900-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 20900-1-AP (ZNF496 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

ZNF496 Polyclonal Antibody for WB, ELISA

Cat No. 20900-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, Rat

Applications

WB, ELISA

Synonyms

NIZP1, zinc finger protein 496, ZKSCAN17, ZNF496

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, PC-12 cells, RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20900-1-AP targets ZNF496 in WB, ELISA applications and shows reactivity with human, mouse, Rat samples.

• Tested Reactivity: human, mouse, Rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15015

  Product name: Recombinant human ZNF496 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 238-587 aa of BC007263

  Sequence: LDPAQTGFYGEFIIGEDYGVSMPPNDLAAQPDLSQGEENEPRVPELQDLQGKEVPQVSYLDSPSLQPFQVEERRKREELQVPEFQACPQTVVPQNTYPAGGNPRSLENSLDEEVTIEIVLSSSGDEDSQHGPYCTEELGSPTEKQRSLPASHRSSTEAGGEVQTSKKSYVCPNCGKIFRWRVNFIRHLRSRREQEKPHECSVCGELFSDSEDLDGHLESHEAQKPYRCGACGKSFRLNSHLLSHRRIHLQPDRLQPVEKREQAASEDADKGPKEPLENGKAKLSFQCCECGKAFQRHDHLARHRSHFHLKDKARPFQCRYCVKSFTQNYDLLRHERLHMKRRSKQALNSY

• Full Name: zinc finger protein 496
• Calculated Molecular Weight: 587 aa, 67 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC007263
• Gene Symbol: ZNF496
• Gene ID (NCBI): 84838
• RRID: AB_2878761
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96IT1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.