ZNF497 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF497 Polyclonal antibody, PBS Only (25178-1-PBS)

• 

  WB analysis of mouse testis using 25178-1-AP (same clone as 25178-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25178-1-AP (ZNF497 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25178-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 25178-1-AP (same clone as 25178-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25178-1-AP (ZNF497 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25178-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 25178-1-AP (same clone as 25178-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 25178-1-AP (ZNF497 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25178-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 25178-1-AP (same clone as 25178-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25178-1-AP (ZNF497 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25178-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 25178-1-AP (same clone as 25178-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 25178-1-AP (ZNF497 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25178-1-PBS in a different storage buffer formulation.

ZNF497 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25178-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

25178-1-PBS targets ZNF497 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18114

  Product name: Recombinant human ZNF497 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-113 aa of BC118983

  Sequence: MESPRGWTLQVAPEEGQVLCNVKTATRGLSEGAVSGGWGAWENSTEVPREAGDGQRQQATLGAADEQGGPGRELGPADGGRDGAGPRSEPADRALRPSPLPEEPGCRCGECGK

• Full Name: zinc finger protein 497
• Calculated Molecular Weight: 498 aa, 55 kDa
• Observed Molecular Weight: 61-65 kDa
• GenBank Accession Number: BC118983
• Gene Symbol: ZNF497
• Gene ID (NCBI): 162968
• RRID: AB_2879944
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZNH5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.