ZNF521 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF521 Polyclonal antibody, PBS Only (23716-1-PBS)

• 

  WB analysis using 23716-1-AP (same clone as 23716-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23716-1-AP (ZNF521 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23716-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 23716-1-AP (same clone as 23716-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using ZNF521 antibody (23716-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 23716-1-PBS in a different storage buffer formulation.

ZNF521 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 23716-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Zfp521, zinc finger protein 521, LYST interacting protein 3, LIP3, Evi3

---

Product Information

23716-1-PBS targets ZNF521 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20540

  Product name: Recombinant human ZNF521 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 195-450 aa of BC113648

  Sequence: THTSNKPYKCAICRRGFLSSSSLHGHMQVHERNKDGSQSGSRMEDWKMKDTQKCSQCEEGFDFPEDLQKHIAECHPECSPNEDRAALQCVYCHELFVEETSLMNHMEQVHSGEKKNSCSICSESFHTVEELYSHMDSHQQPESCNHSNSPSLVTVGYTSVSSTTPDSNLSVDSSTMVEAAPPIPKSRGRKRAAQQTPDMTGPSSKQAKVTYSCIYCNKQLFSSLAVLQIHLKTMHLDKPEQAHICQYCLEVLPSLY

• Full Name: zinc finger protein 521
• Calculated Molecular Weight: 1311 aa, 148 kDa
• Observed Molecular Weight: 190 kDa
• GenBank Accession Number: BC113648
• Gene Symbol: ZNF521
• Gene ID (NCBI): 25925
• RRID: AB_3669415
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96K83
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Zinc finger protein 521 (EHZF/ZNF521) is a transcription co-factor originally identified for its abundant and selective expression in early progenitors of the human hematopoietic system. In the hematopoietic system ZNF521 is highly expressed in stem and progenitor cells but not in more differentiated precursors or mature leukocytes (PMID: 23907569, 21593590).