ZNF530 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF530 Polyclonal antibody (32288-1-AP)

• 

  WB analysis using 32288-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32288-1-AP (ZNF530 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

ZNF530 Polyclonal Antibody for WB, ELISA

Cat No. 32288-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Zinc finger protein 530, KIAA1508

---

Tested Applications

• Positive WB detected in: HEK-293 cells, IMR-32 cells, U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32288-1-AP targets ZNF530 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37782

  Product name: Recombinant human ZNF530 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC060865

  Sequence: MAAALRAPTQQVFVAFEDVAIYFSQEEWELLDEMQRLLYRDVMLENFAVMASLGCWCGAVDEGTPSAESVSVEELSQGRTPKADTSTDKSHPCEICTPVLRDILQMIELQASPCGQKLYLGGAPRDFWMSSNLHQLQKLDNGEKLFKVDGDQASFMMNCRFHVSGKPFTFGEVGRDFSATSGLLQHQVTPTIERPHSRIR

• Full Name: zinc finger protein 530
• Calculated Molecular Weight: 599 aa, 69 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC060865
• Gene Symbol: ZNF530
• Gene ID (NCBI): 348327
• RRID: AB_3742569
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6P9A1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZNF530, also known as zinc finger protein 530, is a member of the zinc finger protein family. ZNF530 is expressed in various tissues, including the brain, heart, liver, and pancreas. It has been shown to play a role in the development and progression of cancer, as well as in the regulation of normal cell development and function.