ZNF557 Polyclonal antibody

• 

  WB analysis of HepG2 using 20500-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 20500-1-AP (ZNF557 Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 20500-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 20500-1-AP (ZNF557 Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 20500-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 20500-1-AP (ZNF557 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

• 

  WB analysis of COLO 320 using 20500-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 20500-1-AP (ZNF557 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

• 

  IF Staining of HepG2 using 20500-1-AP

  Immunofluorescent analysis of HepG2 cells using 20500-1-AP (ZNF557 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

ZNF557 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 20500-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

zinc finger protein 557, ZNF557

---

Tested Applications

• Positive WB detected in: HepG2 cells, A549 cells, COLO 320 cells, HeLa cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20500-1-AP targets ZNF557 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14239

  Product name: Recombinant human ZNF557 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 76-376 aa of BC003020

  Sequence: CRNLASLGNQVDKPRLISQLEQEDKVMTEERGILSGTCPDVENPFKAKGLTPKLHVFRKEQSRNMKMERNHLGATLNECNQCFKVFSTKSSLTRHRKIHTGERPYGCSECGKSYSSRSYLAVHKRIHNGEKPYECNDCGKTFSSRSYLTVHKRIHNGEKPYECSDCGKTFSNSSYLRPHLRIHTGEKPYKCNQCFREFRTQSIFTRHKRVHTGEGHYVCNQCGKAFGTRSSLSSHYSIHTGEYPYECHDCGRTFRRRSNLTQHIRTHTGEKPYTCNECGKSFTNSFSLTIHRRIHNGEKS

• Full Name: zinc finger protein 557
• Calculated Molecular Weight: 423 aa, 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC003020
• Gene Symbol: ZNF557
• Gene ID (NCBI): 79230
• RRID: AB_2878695
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N988
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		J Virol; KRAB-ZFP repressors enforce quiescence of oncogenic human herpesviruses.; Authors - Xiaofan Li