ZNF560 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF560 Polyclonal antibody, PBS Only (21980-1-PBS)

• 

  IF Staining of HEK-293 using 21980-1-AP (same clone as 21980-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using ZNF560 antibody (21980-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 21980-1-PBS in a different storage buffer formulation.

ZNF560 Polyclonal Antibody for IF/ICC, Indirect ELISA

Cat No. 21980-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

Synonyms

zinc finger protein 560

---

Product Information

21980-1-PBS targets ZNF560 in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15921

  Product name: Recombinant human ZNF560 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 186-395 aa of BC101040

  Sequence: GPALWQDNFCLKTLNGIQLARNQNGEELYDCKQCEDVFCKHPCLKTNMSTQNRGNTSECIQYAKDLLSLYNKTSTIRKVSVFSKHGKSFRLILNVQVQRKCTQDKSFEGTDYGKAFIYQSYLEAHRKTQSGEKLNEWKQCGEAFTHSTSHAVNVETHIIKNPYECKECGKDFRYPTHLNNHMQTHIGIKPYKCKHCGKTFTVPSGFLEHV

• Full Name: zinc finger protein 560
• Calculated Molecular Weight: 790 aa, 91 kDa
• GenBank Accession Number: BC101040
• Gene Symbol: ZNF560
• Gene ID (NCBI): 147741
• RRID: AB_3742062
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96MR9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Zinc Finger Protein 560 (ZNF560) is a member of the Krüppel-type (C2H2) zinc finger protein family, characterized by multiple zinc finger domains that mediate DNA binding and transcriptional regulation.