Use Able AI chat for product recommendations

ZNF589 Polyclonal antibody, PBS Only

ZNF589 Polyclonal Antibody for IP, Indirect ELISA

Cat No. 33033-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IP, Indirect ELISA

Stem cell zinc finger protein 1, SZF1, Zinc finger protein 589

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

33033-1-PBS targets ZNF589 in IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag36351

Product name: Recombinant human ZNF589 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 76-250 aa of BC166625

Sequence: ESKPEVHTCPSCPLAFGSQQFLSQDELHNHPIPGFHAGNQLHPGNPCPEDQPQSQHPSDKNHRGAEAEDQRVEGGVRPLFWSTNERGALVGFSSLFQRPPISSWGGNRILEIQLSPAQNASSEEVDRISKRAETPGFGAVTFGECALAFNQKSNLFRQKAVTAEKSSDKRQSQVC

Predict reactive species
Full Name zinc finger protein 589
Observed Molecular Weight47 kDa
GenBank Accession NumberBC166625
Gene Symbol ZNF589
Gene ID (NCBI) 51385
RRIDAB_3742828
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ86UQ0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ZNF589(Zinc Finger Protein 589) is a protein coding gene located at 19q13.43 in human genome, belonging to C2H2 zinc finger protein family. Most members of this family appear in the form of "KRAB-ZNF", that is, the N-terminal has a KRAB(Krüppel-associated box) transcription inhibitory domain, and the C-terminal is a DNA binding domain composed of multiple C2H2 zinc fingers connected in series. ZNF589 also follows this classic structure: KRAB-A/B box at N end, middle linker, and 11 continuous C2H2 zinc fingers at C end. Because KRAB domain can recruit KAP1/TRIM28 and other co-inhibitory complexes, ZNF589 is generally regarded as a potential transcription inhibitor. GTEx data showed that the expression of ZNF589 was low to moderate in almost all adult tissues, with the highest expression in testis, ovary, thyroid, spleen, peripheral blood leukocytes and embryonic stem cells (hESC).

Loading...
||
New chat

Able

正在加载,请稍候...